Pay in 4 interest-free payments of $41.86 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
GeneID: 26019
Immunogen: Recombinant fusion protein of human CLDN18(NP_057453
Expression of this gene is altered in the Alzheimer's disease brain plaques
TNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVC
IκBα Polyclonal Antibody-BS79667 Size:100µl GeneID: 26019IB Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS79667 50, BS79667 100 Product: 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: P25963 Host: Rabbit Reactivity: Human, Mouse Applications: WB All Applications: WB,1: 500 1: 2000 Background: This gene encodes a member of the NF kappa B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF kappa B REL